SCOP 1.73: Domain d1twgk_: 1twg K:

Lineage for d1twgk_ (1twg K:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.74: DCoH-like [55247] (4 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families)
   form homo and heterodimers

5. Family d.74.3.2: RBP11/RpoL [64311] (2 proteins)

6. Protein RPB11 [64312] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64313] (24 PDB entries)

8. Domain d1twgk_: 1twg K: [112749]
   Other proteins in same PDB: d1twga_, d1twgb_, d1twgc1, d1twgc2, d1twge1, d1twge2, d1twgf_, d1twgh_, d1twgi1, d1twgi2, d1twgj_, d1twgl_
   complexed with ctp, mn, zn

Details for d1twgk_

PDB Entry: 1twg, 3.3 Å

PDB Description: RNA polymerase II complexed with CTP

PDB Compounds: (K:) DNA-directed RNA polymerase II 13.6 kDa polypeptide

SCOP Domain Sequences for d1twgk_:

Sequence; same for both SEQRES and ATOM records:

>d1twgk_ d.74.3.2 (K:) RPB11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl

Timeline for d1twgk_:

• d1twgk_ first appeared in SCOP 1.71
  
• d1twgk_ appears in SCOP 1.75
  
• d1twgk_ appears in the current release, SCOPe 2.08