Lineage for d1twgk_ (1twg K:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 605797Fold d.74: DCoH-like [55247] (4 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 605877Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) (S)
    form homo and heterodimers
  5. 605908Family d.74.3.2: RBP11/RpoL [64311] (2 proteins)
  6. 605915Protein RPB11 [64312] (1 species)
  7. 605916Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64313] (9 PDB entries)
  8. 605925Domain d1twgk_: 1twg K: [112749]
    Other proteins in same PDB: d1twga_, d1twgb_, d1twgc1, d1twgc2, d1twge1, d1twge2, d1twgf_, d1twgh_, d1twgi1, d1twgi2, d1twgj_, d1twgl_
    complexed with ctp, mn, zn

Details for d1twgk_

PDB Entry: 1twg (more details), 3.3 Å

PDB Description: RNA polymerase II complexed with CTP
PDB Compounds: (K:)

SCOP Domain Sequences for d1twgk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twgk_ d.74.3.2 (K:) RPB11 {Baker's yeast (Saccharomyces cerevisiae)}
mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl

SCOP Domain Coordinates for d1twgk_:

Click to download the PDB-style file with coordinates for d1twgk_.
(The format of our PDB-style files is described here.)

Timeline for d1twgk_: