SCOP 1.71: Domain d1twgj_: 1twg J:

Lineage for d1twgj_ (1twg J:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family)

5. Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (1 protein)
   Zn-binding site is near the N-terminus

6. Protein RNA polymerase subunit RPB10 [46926] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (9 PDB entries)

8. Domain d1twgj_: 1twg J: [112748]
   Other proteins in same PDB: d1twga_, d1twgb_, d1twgc1, d1twgc2, d1twge1, d1twge2, d1twgf_, d1twgh_, d1twgi1, d1twgi2, d1twgk_, d1twgl_
   complexed with ctp, mn, zn

Details for d1twgj_

PDB Entry: 1twg, 3.3 Å

PDB Description: RNA polymerase II complexed with CTP

SCOP Domain Sequences for d1twgj_:

Sequence; same for both SEQRES and ATOM records:

>d1twgj_ a.4.11.1 (J:) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae)}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lryn

Timeline for d1twgj_:

• d1twgj_ is new in SCOP 1.71
  
• d1twgj_ appears in SCOP 1.73
  
• d1twgj_ appears in the current release, SCOPe 2.08