Lineage for d1twgi2 (1twg I:50-121)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750692Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 750747Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families) (S)
  5. 750748Family g.41.3.1: Transcriptional factor domain [57784] (4 proteins)
  6. 750749Protein RBP9 subunit of RNA polymerase II [57787] (2 species)
    contains two differently decorated domains of this fold
  7. 750752Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries)
  8. 750772Domain d1twgi2: 1twg I:50-121 [112747]
    Other proteins in same PDB: d1twga_, d1twgb_, d1twgc1, d1twgc2, d1twge1, d1twge2, d1twgf_, d1twgh_, d1twgj_, d1twgk_, d1twgl_
    complexed with ctp, mn, zn

Details for d1twgi2

PDB Entry: 1twg (more details), 3.3 Å

PDB Description: RNA polymerase II complexed with CTP
PDB Compounds: (I:) DNA-directed RNA polymerase II 14.2 kDa polypeptide

SCOP Domain Sequences for d1twgi2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twgi2 g.41.3.1 (I:50-121) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tnigetagvvqdigsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshi
ftsdqknkrtqf

SCOP Domain Coordinates for d1twgi2:

Click to download the PDB-style file with coordinates for d1twgi2.
(The format of our PDB-style files is described here.)

Timeline for d1twgi2: