Class b: All beta proteins [48724] (149 folds) |
Fold b.40: OB-fold [50198] (10 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (13 families) |
Family b.40.4.8: RNA polymerase subunit RBP8 [50321] (1 protein) duplication; contains tandem repeat of two incomplete OB-folds; forms a single barrel; n=8, S=10 |
Protein RNA polymerase subunit RBP8 [50322] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50323] (10 PDB entries) |
Domain d1twgh_: 1twg H: [112745] Other proteins in same PDB: d1twga_, d1twgb_, d1twgc1, d1twgc2, d1twge1, d1twge2, d1twgf_, d1twgi1, d1twgi2, d1twgj_, d1twgk_, d1twgl_ complexed with ctp, mn, zn |
PDB Entry: 1twg (more details), 3.3 Å
SCOP Domain Sequences for d1twgh_:
Sequence, based on SEQRES records: (download)
>d1twgh_ b.40.4.8 (H:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae)} sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias slnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggl lmrlegnyrnlnnlkqenayllirr
>d1twgh_ b.40.4.8 (H:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae)} sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias sltrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggllmrlegnyrnln nlkqenayllirr
Timeline for d1twgh_: