SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1twgh_ (1twg H:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2051128Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2052082Family b.40.4.8: RNA polymerase subunit RBP8 [50321] (1 protein)
    duplication; contains tandem repeat of two incomplete OB-folds; forms a single barrel; n=8, S=10
    automatically mapped to Pfam PF03870
  6. 2052083Protein RNA polymerase subunit RBP8 [50322] (2 species)
  7. 2052084Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50323] (35 PDB entries)
    Uniprot P20436
  8. 2052101Domain d1twgh_: 1twg H: [112745]
    Other proteins in same PDB: d1twga_, d1twgb_, d1twgc1, d1twgc2, d1twge1, d1twge2, d1twgf_, d1twgi1, d1twgi2, d1twgj_, d1twgk_, d1twgl_
    protein/RNA complex; complexed with ctp, mn, zn

Details for d1twgh_

PDB Entry: 1twg (more details), 3.3 Å

PDB Description: RNA polymerase II complexed with CTP
PDB Compounds: (H:) DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide

SCOPe Domain Sequences for d1twgh_:

Sequence, based on SEQRES records: (download)

>d1twgh_ b.40.4.8 (H:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
slnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggl
lmrlegnyrnlnnlkqenayllirr

Sequence, based on observed residues (ATOM records): (download)

>d1twgh_ b.40.4.8 (H:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
sltrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggllmrlegnyrnln
nlkqenayllirr

SCOPe Domain Coordinates for d1twgh_:

Click to download the PDB-style file with coordinates for d1twgh_.
(The format of our PDB-style files is described here.)

Timeline for d1twgh_: