![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
![]() | Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) ![]() the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
![]() | Family a.143.1.2: RPB6 [55294] (1 protein) |
![]() | Protein RPB6 [55295] (2 species) essential subunit of RNA polymerases I, II and III |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (24 PDB entries) |
![]() | Domain d1twgf_: 1twg F: [112744] Other proteins in same PDB: d1twga_, d1twgb_, d1twgc1, d1twgc2, d1twge1, d1twge2, d1twgh_, d1twgi1, d1twgi2, d1twgj_, d1twgk_, d1twgl_ complexed with ctp, mn, zn |
PDB Entry: 1twg (more details), 3.3 Å
SCOP Domain Sequences for d1twgf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1twgf_ a.143.1.2 (F:) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip lvirrylpdgsfedwsveelivd
Timeline for d1twgf_: