SCOPe 2.03: Domain d1twge2: 1twg E:144-215

Lineage for d1twge2 (1twg E:144-215)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
   core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (1 family)
   automatically mapped to Pfam PF01191

5. Family d.78.1.1: RPB5 [55288] (2 proteins)

6. Protein Eukaryotic RPB5 C-terminal domain [55292] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (26 PDB entries)
   Uniprot P20434; part of multichain biological unit

8. Domain d1twge2: 1twg E:144-215 [112743]
   Other proteins in same PDB: d1twga_, d1twgb_, d1twgc1, d1twgc2, d1twge1, d1twgf_, d1twgh_, d1twgi1, d1twgi2, d1twgj_, d1twgk_, d1twgl_
   protein/RNA complex; complexed with ctp, mn, zn

Details for d1twge2

PDB Entry: 1twg, 3.3 Å

PDB Description: RNA polymerase II complexed with CTP

PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOPe Domain Sequences for d1twge2:

Sequence; same for both SEQRES and ATOM records:

>d1twge2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

Timeline for d1twge2:

• d1twge2 first appeared in SCOP 1.71
  
• d1twge2 appears in SCOPe 2.02
  
• d1twge2 appears in SCOPe 2.04
  
• d1twge2 appears in the current release, SCOPe 2.08