SCOP 1.71: Domain d1twgc2: 1twg C:42-172

Lineage for d1twgc2 (1twg C:42-172)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
   unusual fold; contains a left-handed beta-alpha-beta unit

4. Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family)

5. Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)

6. Protein RPB3 [64462] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64463] (9 PDB entries)

8. Domain d1twgc2: 1twg C:42-172 [112741]
   Other proteins in same PDB: d1twga_, d1twgb_, d1twgc1, d1twge1, d1twge2, d1twgf_, d1twgh_, d1twgi1, d1twgi2, d1twgj_, d1twgk_, d1twgl_
   complexed with ctp, mn, zn

Details for d1twgc2

PDB Entry: 1twg, 3.3 Å

PDB Description: RNA polymerase II complexed with CTP

SCOP Domain Sequences for d1twgc2:

Sequence; same for both SEQRES and ATOM records:

>d1twgc2 d.181.1.1 (C:42-172) RPB3 {Baker's yeast (Saccharomyces cerevisiae)}
ptlaidsvevetnttvladefiahrlgliplqsmdieqleysrdcfcedhcdkcsvvltl
qafgesesttnvyskdlvivsnlmgrnighpiiqdkegngvlicklrkgqelkltcvakk
giakehakwgp

Timeline for d1twgc2:

• d1twgc2 is new in SCOP 1.71
  
• d1twgc2 appears in SCOP 1.73
  
• d1twgc2 appears in the current release, SCOPe 2.08