SCOP 1.71: Domain d1twgc1: 1twg C:3-41,C:173-268

Lineage for d1twgc1 (1twg C:3-41,C:173-268)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.74: DCoH-like [55247] (4 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families)
   form homo and heterodimers

5. Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)

6. Protein RPB3 [64315] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64316] (9 PDB entries)

8. Domain d1twgc1: 1twg C:3-41,C:173-268 [112740]
   Other proteins in same PDB: d1twga_, d1twgb_, d1twgc2, d1twge1, d1twge2, d1twgf_, d1twgh_, d1twgi1, d1twgi2, d1twgj_, d1twgk_, d1twgl_
   complexed with ctp, mn, zn

Details for d1twgc1

PDB Entry: 1twg, 3.3 Å

PDB Description: RNA polymerase II complexed with CTP

SCOP Domain Sequences for d1twgc1:

Sequence; same for both SEQRES and ATOM records:

>d1twgc1 d.74.3.1 (C:3-41,C:173-268) RPB3 {Baker's yeast (Saccharomyces cerevisiae)}
eegpqvkireaskdnvdfilsnvdlamanslrrvmiaeiXaaaiefeydpwnklkhtdyw
yeqdsakewpqsknceyedppnegdpfdykaqadtfymnvesvgsipvdqvvvrgidtlq
kkvasillaltqmdqd

Timeline for d1twgc1:

• d1twgc1 is new in SCOP 1.71
  
• d1twgc1 appears in SCOP 1.73
  
• d1twgc1 appears in the current release, SCOPe 2.08