Lineage for d1twga_ (1twg A:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1954356Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 1954357Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 1954444Family e.29.1.2: RNA-polymerase beta-prime [64490] (3 proteins)
  6. 1954445Protein RBP1 [64486] (2 species)
  7. 1954446Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64487] (24 PDB entries)
    Uniprot P04050; part of multichain biological unit
  8. 1954456Domain d1twga_: 1twg A: [112738]
    Other proteins in same PDB: d1twgb_, d1twgc1, d1twgc2, d1twge1, d1twge2, d1twgf_, d1twgh_, d1twgi1, d1twgi2, d1twgj_, d1twgk_, d1twgl_
    protein/RNA complex; complexed with ctp, mn, zn

Details for d1twga_

PDB Entry: 1twg (more details), 3.3 Å

PDB Description: RNA polymerase II complexed with CTP
PDB Compounds: (A:) DNA-directed RNA polymerase II largest subunit

SCOPe Domain Sequences for d1twga_:

Sequence, based on SEQRES records: (download)

>d1twga_ e.29.1.2 (A:) RBP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gqqyssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgsid
rnlkcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehnelm
rqalaikdskkrfaaiwtlcktkmvcetdvpseddptqlvsrggcgntqptirkdglklv
gswkkdratgdadepelrvlsteeilnifkhisvkdftslgfnevfsrpewmiltclpvp
pppvrpsisfnesqrgeddltfkladilkanisletlehngaphhaieeaesllqfhvat
ymdndiagqpqalqksgrpvksirarlkgkegrirgnlmgkrvdfsartvisgdpnleld
qvgvpksiaktltypevvtpynidrltqlvrngpnehpgakyvirdsgdridlryskrag
diqlqygwkverhimdndpvlfnrqpslhkmsmmahrvkvipystfrlnlsvtspynadf
dgdemnlhvpqseetraelsqlcavplqivspqsnkpcmgivqdtlcgirkltlrdtfie
ldqvlnmlywvpdwdgviptpaiikpkplwsgkqilsvaipngihlqrfdegttllspkd
ngmliidgqiifgvvekktvgssngglihvvtrekgpqvcaklfgniqkvvnfwllhngf
stgigdtiadgptmreitetiaeakkkvldvtkeaqanlltakhgmtlresfednvvrfl
neardkagrlaevnlkdlnnvkqmvmagskgsfiniaqmsacvgqqsvegkriafgfvdr
tlphfskddyspeskgfvensylrgltpqefffhamggreglidtavktaetgyiqrrlv
kaledimvhydnttrnslgnviqfiygedgmdaahiekqsldtiggsdaafekryrvdll
ntdhtldpsllesgseilgdlklqvlldeeykqlvkdrkflrevfvdgeanwplpvnirr
iiqnaqqtfhidhtkpsdltikdivlgvkdlqenllvlrgkneiiqnaqrdavtlfccll
rsrlatrrvlqeyrltkqafdwvlsnieaqflrsvvhpgemvgvlaaqsigepatqmtln
tfhfagvaskkvtsgvprlkeilnvaknmktpsltvylepghaadqeqaklirsaiehtt
lksvtiaseiyydpdprstvipedeeiiqlhfslldeeaeqsfdqqspwllrleldraam
ndkdltmgqvgerikqtfkndlfviwsedndekliircrvvrpksldaeteaeedhmlkk
ientmlenitlrgveniervvmmkydrkvpsptgeyvkepewvletdgvnlsevmtvpgi
dptriytnsfidimevlgieagraalykevynviasdgsyvnyrhmallvdvmttqgglt
svtrhgfnrsntgalmrcsfeetveilfeagasaelddcrgvsenvilgqmapigtgafd
vmideesl

Sequence, based on observed residues (ATOM records): (download)

>d1twga_ e.29.1.2 (A:) RBP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gqqyssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgsid
rnlkcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehnelm
rqalaikdskkrfaaiwtlcktkmvcetdvpseddptqlvsrggcgntqptirkdglklv
gswkkdratgdadepelrvlsteeilnifkhisvkdftslgfnevfsrpewmiltclpvp
pppvrpdltfkladilkanisletlehngaphhaieeaesllqfhvatymdsiradfsar
tvisgdpnleldqvgvpksiaktltypevvtpynidrltqlvrngpnehpgakyvirdsg
dridlryskragdiqlqygwkverhimdndpvlfnrqpslhkmsmmahrvkvipystfrl
nlsvtspynadfdgdemnlhvpqseetraelsqlcavplqivspqsnkpcmgivqdtlcg
irkltlrdtfieldqvlnmlywvpdwdgviptpaiikpkplwsgkqilsvaipngihlqr
fdegttllspkdngmliidgqiifgvvekktvgssngglihvvtrekgpqvcaklfgniq
kvvnfwllhngfstgigdtiadgptmreitetiaeakkkvldvtkeaqanlltakhgmtl
resfednvvrflneardkagrlaevnlkdlnnvkqmvmagskgsfiniaqmsacvgqqsv
egkriafgfvdrtlphfskddyspeskgfvensylrgltpqefffhamggreglidtavk
taetgyiqrrlvkaledimvhydnttrnslgnviqfiygedgmdaahiekqsldtiggsd
aafekryrvdllntdhtldpsllesgseilgdlklqvlldeeykqlvkdrkflrevfvdg
eanwplpvnirriiqnaqqtfhidhtkpsdltikdivlgvkdlqenllvlrgkneiiqna
qrdavtlfccllrsrlatrrvlqeyrltkqafdwvlsnieaqflrsvvhpgemvgvlaaq
sigepatqmtlkkvtsgvprlkeilnvaknmktpsltvylepghaadqeqaklirsaieh
ttlksvtiaseiyydpdprstvipedeeiiqlhlqqspwllrleldraamndkdltmgqv
gerikqtfkndlfviwsedndekliircrvvaeedhmlkkientmlenitlrgvenierv
vmmkydrkvpsptgeyvkepewvletdgvnlsevmtvpgidptriytnsfidimevlgie
agraalykevynviasdgsyvnyrhmallvdvmttqggltsvttveilfeagasaelddc
rgvsenvilgqmapigtgafdvmideesl

SCOPe Domain Coordinates for d1twga_:

Click to download the PDB-style file with coordinates for d1twga_.
(The format of our PDB-style files is described here.)

Timeline for d1twga_: