Lineage for d1twfk_ (1twf K:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1209032Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 1209136Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) (S)
    form homo and heterodimers
  5. 1209217Family d.74.3.2: RBP11/RpoL [64311] (3 proteins)
  6. 1209224Protein RPB11 [64312] (1 species)
  7. 1209225Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64313] (23 PDB entries)
    Uniprot P38902; part of multichain biological unit
  8. 1209226Domain d1twfk_: 1twf K: [112736]
    Other proteins in same PDB: d1twfa_, d1twfb_, d1twfc1, d1twfc2, d1twfe1, d1twfe2, d1twff_, d1twfh_, d1twfi1, d1twfi2, d1twfj_, d1twfl_
    protein/RNA complex; complexed with mn, utp, zn

Details for d1twfk_

PDB Entry: 1twf (more details), 2.3 Å

PDB Description: RNA polymerase II complexed with UTP at 2.3 A resolution
PDB Compounds: (K:) DNA-directed RNA polymerase II 13.6 kDa polypeptide

SCOPe Domain Sequences for d1twfk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twfk_ d.74.3.2 (K:) RPB11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl

SCOPe Domain Coordinates for d1twfk_:

Click to download the PDB-style file with coordinates for d1twfk_.
(The format of our PDB-style files is described here.)

Timeline for d1twfk_: