![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) ![]() |
![]() | Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (1 protein) Zn-binding site is near the N-terminus |
![]() | Protein RNA polymerase subunit RPB10 [46926] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (24 PDB entries) |
![]() | Domain d1twfj_: 1twf J: [112735] Other proteins in same PDB: d1twfa_, d1twfb_, d1twfc1, d1twfc2, d1twfe1, d1twfe2, d1twff_, d1twfh_, d1twfi1, d1twfi2, d1twfk_, d1twfl_ complexed with mn, utp, zn |
PDB Entry: 1twf (more details), 2.3 Å
SCOP Domain Sequences for d1twfj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1twfj_ a.4.11.1 (J:) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf lrynp
Timeline for d1twfj_: