Lineage for d1twfj_ (1twf J:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532780Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 534099Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) (S)
  5. 534100Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (1 protein)
    Zn-binding site is near the N-terminus
  6. 534101Protein RNA polymerase subunit RPB10 [46926] (2 species)
  7. 534104Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (9 PDB entries)
  8. 534105Domain d1twfj_: 1twf J: [112735]
    Other proteins in same PDB: d1twfa_, d1twfb_, d1twfc1, d1twfc2, d1twfe1, d1twfe2, d1twff_, d1twfh_, d1twfi1, d1twfi2, d1twfk_, d1twfl_
    complexed with mn, utp, zn

Details for d1twfj_

PDB Entry: 1twf (more details), 2.3 Å

PDB Description: RNA polymerase II complexed with UTP at 2.3 A resolution

SCOP Domain Sequences for d1twfj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twfj_ a.4.11.1 (J:) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae)}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynp

SCOP Domain Coordinates for d1twfj_:

Click to download the PDB-style file with coordinates for d1twfj_.
(The format of our PDB-style files is described here.)

Timeline for d1twfj_: