| Class g: Small proteins [56992] (90 folds) |
| Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families) ![]() |
| Family g.41.3.1: Transcriptional factor domain [57784] (4 proteins) |
| Protein RBP9 subunit of RNA polymerase II [57787] (2 species) contains two differently decorated domains of this fold |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries) Uniprot P27999; part of multichain biological unit |
| Domain d1twfi2: 1twf I:50-121 [112734] Other proteins in same PDB: d1twfa_, d1twfb_, d1twfc1, d1twfc2, d1twfe1, d1twfe2, d1twff_, d1twfh_, d1twfj_, d1twfk_, d1twfl_ protein/RNA complex; complexed with mn, utp, zn |
PDB Entry: 1twf (more details), 2.3 Å
SCOPe Domain Sequences for d1twfi2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1twfi2 g.41.3.1 (I:50-121) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tnigetagvvqdigsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshi
ftsdqknkrtqf
Timeline for d1twfi2: