SCOP 1.73: Domain d1twfi1: 1twf I:1-49

Lineage for d1twfi1 (1twf I:1-49)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families)

5. Family g.41.3.1: Transcriptional factor domain [57784] (4 proteins)

6. Protein RBP9 subunit of RNA polymerase II [57787] (2 species)
   contains two differently decorated domains of this fold

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries)

8. Domain d1twfi1: 1twf I:1-49 [112733]
   Other proteins in same PDB: d1twfa_, d1twfb_, d1twfc1, d1twfc2, d1twfe1, d1twfe2, d1twff_, d1twfh_, d1twfj_, d1twfk_, d1twfl_

Details for d1twfi1

PDB Entry: 1twf, 2.3 Å

PDB Description: RNA polymerase II complexed with UTP at 2.3 A resolution

PDB Compounds: (I:) DNA-directed RNA polymerase II 14.2 kDa polypeptide

SCOP Domain Sequences for d1twfi1:

Sequence; same for both SEQRES and ATOM records:

>d1twfi1 g.41.3.1 (I:1-49) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli

Timeline for d1twfi1:

• d1twfi1 first appeared in SCOP 1.71
  
• d1twfi1 appears in SCOP 1.75
  
• d1twfi1 appears in the current release, SCOPe 2.08