SCOPe 2.04: Domain d1twfe2: 1twf E:144-215

Lineage for d1twfe2 (1twf E:144-215)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
   core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families)
   automatically mapped to Pfam PF01191

5. Family d.78.1.1: RPB5 [55288] (2 proteins)

6. Protein Eukaryotic RPB5 C-terminal domain [55292] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (26 PDB entries)
   Uniprot P20434; part of multichain biological unit

8. Domain d1twfe2: 1twf E:144-215 [112730]
   Other proteins in same PDB: d1twfa_, d1twfb_, d1twfc1, d1twfc2, d1twfe1, d1twff_, d1twfh_, d1twfi1, d1twfi2, d1twfj_, d1twfk_, d1twfl_
   protein/RNA complex; complexed with mn, utp, zn

Details for d1twfe2

PDB Entry: 1twf, 2.3 Å

PDB Description: RNA polymerase II complexed with UTP at 2.3 A resolution

PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOPe Domain Sequences for d1twfe2:

Sequence; same for both SEQRES and ATOM records:

>d1twfe2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

Timeline for d1twfe2:

• d1twfe2 first appeared in SCOP 1.71
  
• d1twfe2 appears in SCOPe 2.03
  
• d1twfe2 appears in SCOPe 2.05
  
• d1twfe2 appears in the current release, SCOPe 2.08