SCOP 1.73: Domain d1twfe1: 1twf E:1-143

Lineage for d1twfe1 (1twf E:1-143)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family)

5. Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (1 protein)

6. Protein Eukaryotic RPB5 N-terminal domain [53038] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (25 PDB entries)

8. Domain d1twfe1: 1twf E:1-143 [112729]
   Other proteins in same PDB: d1twfa_, d1twfb_, d1twfc1, d1twfc2, d1twfe2, d1twff_, d1twfh_, d1twfi1, d1twfi2, d1twfj_, d1twfk_, d1twfl_
   complexed with mn, utp, zn

Details for d1twfe1

PDB Entry: 1twf, 2.3 Å

PDB Description: RNA polymerase II complexed with UTP at 2.3 A resolution

PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOP Domain Sequences for d1twfe1:

Sequence; same for both SEQRES and ATOM records:

>d1twfe1 c.52.3.1 (E:1-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsf
qanpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsa
mklvpsippatietfneaalvvn

Timeline for d1twfe1:

• d1twfe1 first appeared in SCOP 1.71
  
• d1twfe1 appears in SCOP 1.75
  
• d1twfe1 appears in the current release, SCOPe 2.08