Lineage for d1twcj_ (1twc J:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1985075Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) (S)
    automatically mapped to Pfam PF01194
  5. 1985076Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins)
    Zn-binding site is near the N-terminus
  6. 1985077Protein RNA polymerase subunit RPB10 [46926] (3 species)
  7. 1985078Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (28 PDB entries)
    Uniprot P22139; part of multichain biological unit
  8. 1985083Domain d1twcj_: 1twc J: [112721]
    Other proteins in same PDB: d1twca_, d1twcb_, d1twcc1, d1twcc2, d1twce1, d1twce2, d1twcf_, d1twch_, d1twci1, d1twci2, d1twck_, d1twcl_
    protein/RNA complex; complexed with gtp, mn, zn

Details for d1twcj_

PDB Entry: 1twc (more details), 3 Å

PDB Description: RNA polymerase II complexed with GTP
PDB Compounds: (J:) DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide

SCOPe Domain Sequences for d1twcj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twcj_ a.4.11.1 (J:) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lryn

SCOPe Domain Coordinates for d1twcj_:

Click to download the PDB-style file with coordinates for d1twcj_.
(The format of our PDB-style files is described here.)

Timeline for d1twcj_: