Class g: Small proteins [56992] (79 folds) |
Fold g.41: Rubredoxin-like [57769] (14 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.3: Zinc beta-ribbon [57783] (4 families) |
Family g.41.3.1: Transcriptional factor domain [57784] (4 proteins) |
Protein RBP9 subunit of RNA polymerase II [57787] (2 species) contains two differently decorated domains of this fold |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (9 PDB entries) |
Domain d1twci2: 1twc I:50-121 [112720] Other proteins in same PDB: d1twca_, d1twcb_, d1twcc1, d1twcc2, d1twce1, d1twce2, d1twcf_, d1twch_, d1twcj_, d1twck_, d1twcl_ complexed with gtp, mn, zn |
PDB Entry: 1twc (more details), 3 Å
SCOP Domain Sequences for d1twci2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1twci2 g.41.3.1 (I:50-121) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae)} tnigetagvvqdigsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshi ftsdqknkrtqf
Timeline for d1twci2: