SCOP 1.73: Domain d1twci1: 1twc I:1-49

Lineage for d1twci1 (1twc I:1-49)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families)

5. Family g.41.3.1: Transcriptional factor domain [57784] (4 proteins)

6. Protein RBP9 subunit of RNA polymerase II [57787] (2 species)
   contains two differently decorated domains of this fold

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries)

8. Domain d1twci1: 1twc I:1-49 [112719]
   Other proteins in same PDB: d1twca_, d1twcb_, d1twcc1, d1twcc2, d1twce1, d1twce2, d1twcf_, d1twch_, d1twcj_, d1twck_, d1twcl_

Details for d1twci1

PDB Entry: 1twc, 3 Å

PDB Description: RNA polymerase II complexed with GTP

PDB Compounds: (I:) DNA-directed RNA polymerase II 14.2kd polypeptide

SCOP Domain Sequences for d1twci1:

Sequence; same for both SEQRES and ATOM records:

>d1twci1 g.41.3.1 (I:1-49) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli

Timeline for d1twci1:

• d1twci1 first appeared in SCOP 1.71
  
• d1twci1 appears in SCOP 1.75
  
• d1twci1 appears in the current release, SCOPe 2.08