Lineage for d1twcf_ (1twc F:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1100304Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 1100305Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 1100342Family a.143.1.2: RPB6 [55294] (1 protein)
  6. 1100343Protein RPB6 [55295] (2 species)
    essential subunit of RNA polymerases I, II and III
  7. 1100344Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (29 PDB entries)
    Uniprot P20435; part of multichain biological unit
  8. 1100351Domain d1twcf_: 1twc F: [112717]
    Other proteins in same PDB: d1twca_, d1twcb_, d1twcc1, d1twcc2, d1twce1, d1twce2, d1twch_, d1twci1, d1twci2, d1twcj_, d1twck_, d1twcl_
    protein/RNA complex; complexed with gtp, mn, zn

Details for d1twcf_

PDB Entry: 1twc (more details), 3 Å

PDB Description: RNA polymerase II complexed with GTP
PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide

SCOPe Domain Sequences for d1twcf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twcf_ a.143.1.2 (F:) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivd

SCOPe Domain Coordinates for d1twcf_:

Click to download the PDB-style file with coordinates for d1twcf_.
(The format of our PDB-style files is described here.)

Timeline for d1twcf_: