SCOPe 2.05: Domain d1twcc1: 1twc C:3-41,C:173-268

Lineage for d1twcc1 (1twc C:3-41,C:173-268)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families)
   form homo and heterodimers

5. Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)

6. Protein RPB3 [64315] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64316] (24 PDB entries)
   Uniprot P16370; part of multichain biological unit

8. Domain d1twcc1: 1twc C:3-41,C:173-268 [112713]
   Other proteins in same PDB: d1twca_, d1twcb_, d1twcc2, d1twce1, d1twce2, d1twcf_, d1twch_, d1twci1, d1twci2, d1twcj_, d1twck_, d1twcl_
   protein/RNA complex; complexed with gtp, mn, zn

Details for d1twcc1

PDB Entry: 1twc, 3 Å

PDB Description: RNA polymerase II complexed with GTP

PDB Compounds: (C:) DNA-directed RNA polymerase II 45 kDa polypeptide

SCOPe Domain Sequences for d1twcc1:

Sequence; same for both SEQRES and ATOM records:

>d1twcc1 d.74.3.1 (C:3-41,C:173-268) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eegpqvkireaskdnvdfilsnvdlamanslrrvmiaeiXaaaiefeydpwnklkhtdyw
yeqdsakewpqsknceyedppnegdpfdykaqadtfymnvesvgsipvdqvvvrgidtlq
kkvasillaltqmdqd

Timeline for d1twcc1:

• d1twcc1 first appeared in SCOP 1.71
  
• d1twcc1 appears in SCOPe 2.04
  
• d1twcc1 appears in SCOPe 2.06
  
• d1twcc1 appears in the current release, SCOPe 2.08