Lineage for d1twai1 (1twa I:1-49)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 624613Fold g.41: Rubredoxin-like [57769] (14 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 624668Superfamily g.41.3: Zinc beta-ribbon [57783] (4 families) (S)
  5. 624669Family g.41.3.1: Transcriptional factor domain [57784] (4 proteins)
  6. 624670Protein RBP9 subunit of RNA polymerase II [57787] (2 species)
    contains two differently decorated domains of this fold
  7. 624673Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (9 PDB entries)
  8. 624684Domain d1twai1: 1twa I:1-49 [112704]
    Other proteins in same PDB: d1twaa_, d1twab_, d1twac1, d1twac2, d1twae1, d1twae2, d1twaf_, d1twah_, d1twaj_, d1twak_, d1twal_

Details for d1twai1

PDB Entry: 1twa (more details), 3.2 Å

PDB Description: RNA polymerase II complexed with ATP

SCOP Domain Sequences for d1twai1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twai1 g.41.3.1 (I:1-49) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae)}
mttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli

SCOP Domain Coordinates for d1twai1:

Click to download the PDB-style file with coordinates for d1twai1.
(The format of our PDB-style files is described here.)

Timeline for d1twai1: