Lineage for d1twae2 (1twa E:144-215)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1209496Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
    core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta
  4. 1209497Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (1 family) (S)
  5. 1209498Family d.78.1.1: RPB5 [55288] (2 proteins)
  6. 1209499Protein Eukaryotic RPB5 C-terminal domain [55292] (1 species)
  7. 1209500Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (25 PDB entries)
    Uniprot P20434; part of multichain biological unit
  8. 1209508Domain d1twae2: 1twa E:144-215 [112701]
    Other proteins in same PDB: d1twaa_, d1twab_, d1twac1, d1twac2, d1twae1, d1twaf_, d1twah_, d1twai1, d1twai2, d1twaj_, d1twak_, d1twal_
    protein/RNA complex; complexed with atp, mn, zn

Details for d1twae2

PDB Entry: 1twa (more details), 3.2 Å

PDB Description: RNA polymerase II complexed with ATP
PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOPe Domain Sequences for d1twae2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twae2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

SCOPe Domain Coordinates for d1twae2:

Click to download the PDB-style file with coordinates for d1twae2.
(The format of our PDB-style files is described here.)

Timeline for d1twae2: