![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
![]() | Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family) ![]() |
![]() | Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (1 protein) |
![]() | Protein Eukaryotic RPB5 N-terminal domain [53038] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (25 PDB entries) |
![]() | Domain d1twae1: 1twa E:1-143 [112700] Other proteins in same PDB: d1twaa_, d1twab_, d1twac1, d1twac2, d1twae2, d1twaf_, d1twah_, d1twai1, d1twai2, d1twaj_, d1twak_, d1twal_ complexed with atp, mn, zn |
PDB Entry: 1twa (more details), 3.2 Å
SCOP Domain Sequences for d1twae1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1twae1 c.52.3.1 (E:1-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mdqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsf qanpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsa mklvpsippatietfneaalvvn
Timeline for d1twae1: