Lineage for d1tw6b_ (1tw6 B:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1067283Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 1067284Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) (S)
  5. 1067285Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 1067364Protein BIR-containing protein 7 (ML-IAP, livin) [103630] (1 species)
  7. 1067365Species Human (Homo sapiens) [TaxId:9606] [103631] (6 PDB entries)
    Uniprot Q96CA5 78-159
  8. 1067369Domain d1tw6b_: 1tw6 B: [112695]
    BIR2; alternative splicing
    complexed with btb, edo, li, zn

Details for d1tw6b_

PDB Entry: 1tw6 (more details), 1.71 Å

PDB Description: structure of an ml-iap/xiap chimera bound to a 9mer peptide derived from smac
PDB Compounds: (B:) Baculoviral IAP repeat-containing protein 7

SCOPe Domain Sequences for d1tw6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tw6b_ g.52.1.1 (B:) BIR-containing protein 7 (ML-IAP, livin) {Human (Homo sapiens) [TaxId: 9606]}
gpafpgmgseelrlasfydwpltaevppellaaagffhtghqdkvrcffcygglqswkrg
ddpwtehakwfpgcqfllrskgqeyinnihlthsl

SCOPe Domain Coordinates for d1tw6b_:

Click to download the PDB-style file with coordinates for d1tw6b_.
(The format of our PDB-style files is described here.)

Timeline for d1tw6b_: