SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1tw5b_ (1tw5 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133085Family c.68.1.2: beta 1,4 galactosyltransferase (b4GalT1) [53452] (2 protein domains)
  6. 2133086Protein beta 1,4 galactosyltransferase (b4GalT1) [53453] (1 species)
  7. 2133087Species Cow (Bos taurus) [TaxId:9913] [53454] (30 PDB entries)
    Uniprot P08037 131-402
  8. 2133116Domain d1tw5b_: 1tw5 B: [112693]
    complexed with cbs, dio, mes, mn, so4, udh; mutant

Details for d1tw5b_

PDB Entry: 1tw5 (more details), 2.3 Å

PDB Description: beta1,4-galactosyltransferase mutant M344H-Gal-T1 in complex with Chitobiose
PDB Compounds: (B:) Beta-1,4-galactosyltransferase 1

SCOPe Domain Sequences for d1tw5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tw5b_ c.68.1.2 (B:) beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos taurus) [TaxId: 9913]}
ltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrn
rqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvf
sdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnn
ywgwggedddiynrlafrgmsvsrpnavigktrhirhsrdkknepnpqrfdriahtketm
lsdglnsltymvlevqryplytkitvdigtps

SCOPe Domain Coordinates for d1tw5b_:

Click to download the PDB-style file with coordinates for d1tw5b_.
(The format of our PDB-style files is described here.)

Timeline for d1tw5b_: