Lineage for d1tw4b_ (1tw4 B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 564341Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 564342Superfamily b.60.1: Lipocalins [50814] (5 families) (S)
    bind hydrophobic ligands in their interior
  5. 564567Family b.60.1.2: Fatty acid binding protein-like [50847] (16 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 564676Protein Liver basic fatty acid binding protein, LB_FABP [89368] (2 species)
  7. 564679Species Chicken (Gallus gallus) [TaxId:9031] [89369] (3 PDB entries)
  8. 564681Domain d1tw4b_: 1tw4 B: [112691]
    complexed with chd

Details for d1tw4b_

PDB Entry: 1tw4 (more details), 2 Å

PDB Description: crystal structure of chicken liver basic fatty acid binding protein (bile acid binding protein) complexed with cholic acid

SCOP Domain Sequences for d1tw4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tw4b_ b.60.1.2 (B:) Liver basic fatty acid binding protein, LB_FABP {Chicken (Gallus gallus)}
afsgtwqvyaqenyeeflkalalpedlikmardikpiveiqqkgddfvvtsktprqtvtn
sftlgkeadittmdgkklkctvhlangklvtksekfsheqevkgnemvetitfggvtlir
rskrv

SCOP Domain Coordinates for d1tw4b_:

Click to download the PDB-style file with coordinates for d1tw4b_.
(The format of our PDB-style files is described here.)

Timeline for d1tw4b_: