SCOP 1.71: Domain d1tw4a_: 1tw4 A:

Lineage for d1tw4a_ (1tw4 A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (5 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (16 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Liver basic fatty acid binding protein, LB_FABP [89368] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [89369] (3 PDB entries)

8. Domain d1tw4a_: 1tw4 A: [112690]

Details for d1tw4a_

PDB Entry: 1tw4, 2 Å

PDB Description: crystal structure of chicken liver basic fatty acid binding protein (bile acid binding protein) complexed with cholic acid

SCOP Domain Sequences for d1tw4a_:

Sequence; same for both SEQRES and ATOM records:

>d1tw4a_ b.60.1.2 (A:) Liver basic fatty acid binding protein, LB_FABP {Chicken (Gallus gallus)}
afsgtwqvyaqenyeeflkalalpedlikmardikpiveiqqkgddfvvtsktprqtvtn
sftlgkeadittmdgkklkctvhlangklvtksekfsheqevkgnemvetitfggvtlir
rskrv

Timeline for d1tw4a_:

• d1tw4a_ is new in SCOP 1.71
  
• d1tw4a_ appears in SCOP 1.73
  
• d1tw4a_ appears in the current release, SCOPe 2.08