Class b: All beta proteins [48724] (180 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
Protein Liver basic fatty acid binding protein, LB_FABP [89368] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [89369] (3 PDB entries) Uniprot P80226 |
Domain d1tw4a_: 1tw4 A: [112690] complexed with chd |
PDB Entry: 1tw4 (more details), 2 Å
SCOPe Domain Sequences for d1tw4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tw4a_ b.60.1.2 (A:) Liver basic fatty acid binding protein, LB_FABP {Chicken (Gallus gallus) [TaxId: 9031]} afsgtwqvyaqenyeeflkalalpedlikmardikpiveiqqkgddfvvtsktprqtvtn sftlgkeadittmdgkklkctvhlangklvtksekfsheqevkgnemvetitfggvtlir rskrv
Timeline for d1tw4a_: