Lineage for d1tw4a_ (1tw4 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2395396Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2395397Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2395948Family b.60.1.2: Fatty acid binding protein-like [50847] (18 protein domains)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2396192Protein Liver basic fatty acid binding protein, LB_FABP [89368] (3 species)
  7. 2396197Species Chicken (Gallus gallus) [TaxId:9031] [89369] (3 PDB entries)
    Uniprot P80226
  8. 2396199Domain d1tw4a_: 1tw4 A: [112690]
    complexed with chd

Details for d1tw4a_

PDB Entry: 1tw4 (more details), 2 Å

PDB Description: crystal structure of chicken liver basic fatty acid binding protein (bile acid binding protein) complexed with cholic acid
PDB Compounds: (A:) fatty acid-binding protein

SCOPe Domain Sequences for d1tw4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tw4a_ b.60.1.2 (A:) Liver basic fatty acid binding protein, LB_FABP {Chicken (Gallus gallus) [TaxId: 9031]}
afsgtwqvyaqenyeeflkalalpedlikmardikpiveiqqkgddfvvtsktprqtvtn
sftlgkeadittmdgkklkctvhlangklvtksekfsheqevkgnemvetitfggvtlir
rskrv

SCOPe Domain Coordinates for d1tw4a_:

Click to download the PDB-style file with coordinates for d1tw4a_.
(The format of our PDB-style files is described here.)

Timeline for d1tw4a_: