SCOPe 2.06: Domain d1tvia_: 1tvi A:

Lineage for d1tvia_ (1tvi A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.15: Predicted metal-dependent hydrolase [103132] (4 proteins)
   Pfam PF02130; UPF0054; COG0319; MMP-like fold with a different sequence motif in the putative active site

6. Protein Hypothetical protein TM1509 [118050] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [118051] (1 PDB entry)
   Uniprot Q9X1J7

8. Domain d1tvia_: 1tvi A: [112684]
   Structural genomics target

Details for d1tvia_

PDB Entry: 1tvi

PDB Description: solution structure of tm1509 from thermotoga maritima: vt1, a nesgc target protein

PDB Compounds: (A:) Hypothetical UPF0054 protein TM1509

SCOPe Domain Sequences for d1tvia_:

Sequence; same for both SEQRES and ATOM records:

>d1tvia_ d.92.1.15 (A:) Hypothetical protein TM1509 {Thermotoga maritima [TaxId: 2336]}
mirilgegkgskllenlkekleeivkkeigdvhvnvilvsedeikelnqqfrgqdrptdv
ltfplmeedvygeiyvcpliveenarefnntfekellevvihgilhlagydhefedknsk
emfekqkkyveevwgewrsnpsedsdpgkr

Timeline for d1tvia_:

• d1tvia_ first appeared in SCOP 1.71
  
• d1tvia_ appears in SCOPe 2.05
  
• d1tvia_ appears in SCOPe 2.07
  
• d1tvia_ appears in the current release, SCOPe 2.08