Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) |
Family d.92.1.15: Predicted metal-dependent hydrolase [103132] (4 proteins) Pfam PF02130; UPF0054; COG0319; MMP-like fold with a different sequence motif in the putative active site |
Protein Hypothetical protein TM1509 [118050] (1 species) |
Species Thermotoga maritima [TaxId:2336] [118051] (1 PDB entry) Uniprot Q9X1J7 |
Domain d1tvia_: 1tvi A: [112684] Structural genomics target |
PDB Entry: 1tvi (more details)
SCOPe Domain Sequences for d1tvia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tvia_ d.92.1.15 (A:) Hypothetical protein TM1509 {Thermotoga maritima [TaxId: 2336]} mirilgegkgskllenlkekleeivkkeigdvhvnvilvsedeikelnqqfrgqdrptdv ltfplmeedvygeiyvcpliveenarefnntfekellevvihgilhlagydhefedknsk emfekqkkyveevwgewrsnpsedsdpgkr
Timeline for d1tvia_: