![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (27 families) ![]() |
![]() | Family b.18.1.9: APC10-like [69210] (2 proteins) Pfam 03256 |
![]() | Protein Placental protein 25, pp25 [117104] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117105] (2 PDB entries) |
![]() | Domain d1tvga_: 1tvg A: [112683] Structural genomics target complexed with ca, sm; mutant |
PDB Entry: 1tvg (more details), 1.6 Å
SCOP Domain Sequences for d1tvga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tvga_ b.18.1.9 (A:) Placental protein 25, pp25 {Human (Homo sapiens)} idlclssegsevilatssdekhppeniidgnpetfwtttgmfpqefiicfhkhvrierlv iqsyfvqtlkiekstskepvdfeqwiekdlvhtegqlqneeivahgsatylrfiivsafd hfasvhsvsaegtvvs
Timeline for d1tvga_: