SCOP 1.71: Domain d1tvga_: 1tvg A:

Lineage for d1tvga_ (1tvg A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (27 families)

5. Family b.18.1.9: APC10-like [69210] (2 proteins)
   Pfam 03256

6. Protein Placental protein 25, pp25 [117104] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117105] (2 PDB entries)

8. Domain d1tvga_: 1tvg A: [112683]
   Structural genomics target
   complexed with ca, sm; mutant

Details for d1tvga_

PDB Entry: 1tvg, 1.6 Å

PDB Description: X-ray structure of human PP25 gene product, HSPC034. Northeast Structural Genomics Target HR1958.

SCOP Domain Sequences for d1tvga_:

Sequence; same for both SEQRES and ATOM records:

>d1tvga_ b.18.1.9 (A:) Placental protein 25, pp25 {Human (Homo sapiens)}
idlclssegsevilatssdekhppeniidgnpetfwtttgmfpqefiicfhkhvrierlv
iqsyfvqtlkiekstskepvdfeqwiekdlvhtegqlqneeivahgsatylrfiivsafd
hfasvhsvsaegtvvs

Timeline for d1tvga_:

• d1tvga_ is new in SCOP 1.71
  
• d1tvga_ appears in SCOP 1.73
  
• d1tvga_ appears in the current release, SCOPe 2.08