Lineage for d1tvga_ (1tvg A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774509Family b.18.1.9: APC10-like [69210] (2 proteins)
    Pfam PF03256
  6. 2774516Protein Placental protein 25, pp25 [117104] (1 species)
  7. 2774517Species Human (Homo sapiens) [TaxId:9606] [117105] (2 PDB entries)
    Uniprot Q9Y547
  8. 2774518Domain d1tvga_: 1tvg A: [112683]
    Structural genomics target
    complexed with ca, sm

Details for d1tvga_

PDB Entry: 1tvg (more details), 1.6 Å

PDB Description: X-ray structure of human PP25 gene product, HSPC034. Northeast Structural Genomics Target HR1958.
PDB Compounds: (A:) LOC51668 protein

SCOPe Domain Sequences for d1tvga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tvga_ b.18.1.9 (A:) Placental protein 25, pp25 {Human (Homo sapiens) [TaxId: 9606]}
idlclssegsevilatssdekhppeniidgnpetfwtttgmfpqefiicfhkhvrierlv
iqsyfvqtlkiekstskepvdfeqwiekdlvhtegqlqneeivahgsatylrfiivsafd
hfasvhsvsaegtvvs

SCOPe Domain Coordinates for d1tvga_:

Click to download the PDB-style file with coordinates for d1tvga_.
(The format of our PDB-style files is described here.)

Timeline for d1tvga_: