SCOP 1.73: Domain d1tvca2: 1tvc A:111-251

Lineage for d1tvca2 (1tvc A:111-251)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.2: Aromatic dioxygenase reductase-like [52359] (3 proteins)
   contains additional 2Fe-2S ferredoxin domain at one of the termini

6. Protein Methane monooxygenase component C, MmoC [117485] (1 species)

7. Species Methylococcus capsulatus [TaxId:414] [117486] (1 PDB entry)

8. Domain d1tvca2: 1tvc A:111-251 [112682]
   Other proteins in same PDB: d1tvca1
   complexed with fda

Details for d1tvca2

PDB Entry: 1tvc

PDB Description: fad and nadh binding domain of methane monooxygenase reductase from methylococcus capsulatus (bath)

PDB Compounds: (A:) methane monooxygenase component c

SCOP Domain Sequences for d1tvca2:

Sequence; same for both SEQRES and ATOM records:

>d1tvca2 c.25.1.2 (A:111-251) Methane monooxygenase component C, MmoC {Methylococcus capsulatus [TaxId: 414]}
fglkergmapryfvaggtglapvvsmvrqmqewtapnetriyfgvntepelfyidelksl
ersmrnltvkacvwhpsgdwegeqgspidalredlessdanpdiylcgppgmidaacelv
rsrgipgeqvffekflpsgaa

Timeline for d1tvca2:

• d1tvca2 first appeared in SCOP 1.71
  
• d1tvca2 appears in SCOP 1.75
  
• d1tvca2 appears in the current release, SCOPe 2.08