SCOPe 2.07: Domain d1tvca1: 1tvc A:2-110

Lineage for d1tvca1 (1tvc A:2-110)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
   coupled with a NADP-binding domain of alpha/beta class

6. Protein Methane monooxygenase component C, MmoC [117216] (1 species)

7. Species Methylococcus capsulatus [TaxId:414] [117217] (1 PDB entry)
   Uniprot P22868 99-348 # structure of the N-terminal, 2Fe-2S ferredoxin domain is also known (1JQ4; (69669))

8. Domain d1tvca1: 1tvc A:2-110 [112681]
   Other proteins in same PDB: d1tvca2
   complexed with fda

Details for d1tvca1

PDB Entry: 1tvc

PDB Description: fad and nadh binding domain of methane monooxygenase reductase from methylococcus capsulatus (bath)

PDB Compounds: (A:) methane monooxygenase component c

SCOPe Domain Sequences for d1tvca1:

Sequence; same for both SEQRES and ATOM records:

>d1tvca1 b.43.4.2 (A:2-110) Methane monooxygenase component C, MmoC {Methylococcus capsulatus [TaxId: 414]}
crisfgevgsfeaevvglnwvssntvqfllqkrpdecgnrgvkfepgqfmdltipgtdvs
rsyspanlpnpegrleflirvlpegrfsdylrndarvgqvlsvkgplgv

Timeline for d1tvca1:

• d1tvca1 first appeared in SCOP 1.71
  
• d1tvca1 appears in SCOPe 2.06
  
• d1tvca1 appears in the current release, SCOPe 2.08