![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) ![]() |
![]() | Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins) coupled with a NADP-binding domain of alpha/beta class |
![]() | Protein Methane monooxygenase component C, MmoC [117216] (1 species) |
![]() | Species Methylococcus capsulatus [TaxId:414] [117217] (1 PDB entry) Uniprot P22868 99-348 # structure of the N-terminal, 2Fe-2S ferredoxin domain is also known (1JQ4; (69669)) |
![]() | Domain d1tvca1: 1tvc A:2-110 [112681] Other proteins in same PDB: d1tvca2 complexed with fda |
PDB Entry: 1tvc (more details)
SCOPe Domain Sequences for d1tvca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tvca1 b.43.4.2 (A:2-110) Methane monooxygenase component C, MmoC {Methylococcus capsulatus [TaxId: 414]} crisfgevgsfeaevvglnwvssntvqfllqkrpdecgnrgvkfepgqfmdltipgtdvs rsyspanlpnpegrleflirvlpegrfsdylrndarvgqvlsvkgplgv
Timeline for d1tvca1: