Lineage for d1tvaa1 (1tva A:5-91)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998615Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1999012Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1999013Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 protein domains)
  6. 1999014Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
    topologically similar to the second domain
  7. 1999015Species Human (Homo sapiens) [TaxId:9606] [47805] (145 PDB entries)
    Uniprot P06746
  8. 1999058Domain d1tvaa1: 1tva A:5-91 [112678]
    Other proteins in same PDB: d1tvaa2, d1tvaa3
    protein/DNA complex; complexed with mg, na, po4

Details for d1tvaa1

PDB Entry: 1tva (more details), 2.6 Å

PDB Description: human dna polymerase beta complexed with nicked dna containing a mismatched template thymidine and incoming cytidine
PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d1tvaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tvaa1 a.60.6.1 (A:5-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens) [TaxId: 9606]}
kapqetlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpg
vgtkiaekideflatgklrklekirqd

SCOPe Domain Coordinates for d1tvaa1:

Click to download the PDB-style file with coordinates for d1tvaa1.
(The format of our PDB-style files is described here.)

Timeline for d1tvaa1: