Lineage for d1tv9a2 (1tv9 A:92-148)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328564Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2329531Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2329532Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
    automatically mapped to Pfam PF10391
  6. 2329533Protein DNA polymerase beta [81579] (2 species)
  7. 2329534Species Human (Homo sapiens) [TaxId:9606] [81575] (145 PDB entries)
  8. 2329537Domain d1tv9a2: 1tv9 A:92-148 [112676]
    Other proteins in same PDB: d1tv9a1, d1tv9a3
    protein/DNA complex; complexed with mg, na, po4

Details for d1tv9a2

PDB Entry: 1tv9 (more details), 2 Å

PDB Description: human dna polymerase beta complexed with nicked dna containing a mismatched template adenine and incoming cytidine
PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d1tv9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tv9a2 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek

SCOPe Domain Coordinates for d1tv9a2:

Click to download the PDB-style file with coordinates for d1tv9a2.
(The format of our PDB-style files is described here.)

Timeline for d1tv9a2: