Lineage for d1tv9a1 (1tv9 A:5-91)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 539305Fold a.60: SAM domain-like [47768] (14 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 539465Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 539466Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 539467Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
    topologically similar to the second domain
  7. 539468Species Human (Homo sapiens) [TaxId:9606] [47805] (94 PDB entries)
  8. 539469Domain d1tv9a1: 1tv9 A:5-91 [112675]
    Other proteins in same PDB: d1tv9a2, d1tv9a3
    complexed with mg, na, po4

Details for d1tv9a1

PDB Entry: 1tv9 (more details), 2 Å

PDB Description: human dna polymerase beta complexed with nicked dna containing a mismatched template adenine and incoming cytidine

SCOP Domain Sequences for d1tv9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tv9a1 a.60.6.1 (A:5-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens)}
kapqetlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpg
vgtkiaekideflatgklrklekirqd

SCOP Domain Coordinates for d1tv9a1:

Click to download the PDB-style file with coordinates for d1tv9a1.
(The format of our PDB-style files is described here.)

Timeline for d1tv9a1: