Lineage for d1tv3a_ (1tv3 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2102403Superfamily c.1.25: Monomethylamine methyltransferase MtmB [75098] (1 family) (S)
    automatically mapped to Pfam PF05369
  5. 2102404Family c.1.25.1: Monomethylamine methyltransferase MtmB [75099] (1 protein)
  6. 2102405Protein Monomethylamine methyltransferase MtmB [75100] (1 species)
    contains a UAG-encoded L-pyrrolysine residue
  7. 2102406Species Methanosarcina barkeri [TaxId:2208] [75101] (6 PDB entries)
    Uniprot O30642
  8. 2102412Domain d1tv3a_: 1tv3 A: [112673]
    complexed with bg4

Details for d1tv3a_

PDB Entry: 1tv3 (more details), 2.2 Å

PDB Description: Crystal structure of the N-methyl-hydroxylamine MtmB complex
PDB Compounds: (A:) Monomethylamine methyltransferase mtmB1

SCOPe Domain Sequences for d1tv3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tv3a_ c.1.25.1 (A:) Monomethylamine methyltransferase MtmB {Methanosarcina barkeri [TaxId: 2208]}
tfrksfdcydfydrakvgekctqddwdlmkipmkamelkqkygldfkgefiptdkdmmek
lfkagfemllecgiyctdthrivkytedeiwdainnvqkefvlgtgrdavnvrkrsvgdk
akpivqggptgspisedvfmpvhmsyalekevdtivngvmtsvrgkspipkspyevlaak
tetrliknacamagrpgmgvkgpetslsaqgnisadctggmtctdshevsqlnelkidld
aisviahykgnsdiimdeqmpifggyaggieettivdvathinavlmssaswhldgpvhi
rwgstntretlmiagwacatiseftdilsgnqyypcagpctemclleasaqsitdtasgr
eilsgvasakgvvtdkttgmearmmgevaratagveisevnvildklvslyeknyasapa
gktfqecydvktvtpteeymqvydgarkkledlglvf

SCOPe Domain Coordinates for d1tv3a_:

Click to download the PDB-style file with coordinates for d1tv3a_.
(The format of our PDB-style files is described here.)

Timeline for d1tv3a_: