![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 proteins) |
![]() | Protein Diacylglycerol kinase alpha, N-terminal domain [116905] (1 species) contains two pairs of EF-hands, the modified first pair (res 25-109) does not bind calcium but retains the common fold |
![]() | Species Human (Homo sapiens) [TaxId:9606] [116906] (1 PDB entry) Uniprot O95217 P23743 1-116 |
![]() | Domain d1tuza_: 1tuz A: [112670] structural genomics target |
PDB Entry: 1tuz (more details)
SCOPe Domain Sequences for d1tuza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} makerglispsdfaqlqkymeystkkvsdvlklfedgemakyvqgdaigyegfqqflkiy levdnvprhlslalfqsfetghclnetnvtkdvvclndvscyfslleggrpedklews
Timeline for d1tuza_: