Lineage for d1tuza_ (1tuz A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711389Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 proteins)
  6. 2711415Protein Diacylglycerol kinase alpha, N-terminal domain [116905] (1 species)
    contains two pairs of EF-hands, the modified first pair (res 25-109) does not bind calcium but retains the common fold
  7. 2711416Species Human (Homo sapiens) [TaxId:9606] [116906] (1 PDB entry)
    Uniprot O95217 P23743 1-116
  8. 2711417Domain d1tuza_: 1tuz A: [112670]
    structural genomics target

Details for d1tuza_

PDB Entry: 1tuz (more details)

PDB Description: nmr structure of the diacylglycerol kinase alpha, nesgc target hr532
PDB Compounds: (A:) diacylglycerol kinase alpha

SCOPe Domain Sequences for d1tuza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
makerglispsdfaqlqkymeystkkvsdvlklfedgemakyvqgdaigyegfqqflkiy
levdnvprhlslalfqsfetghclnetnvtkdvvclndvscyfslleggrpedklews

SCOPe Domain Coordinates for d1tuza_:

Click to download the PDB-style file with coordinates for d1tuza_.
(The format of our PDB-style files is described here.)

Timeline for d1tuza_: