![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (17 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
![]() | Family d.58.4.11: PA3566-like [110970] (3 proteins) subfamily of Pfam PF03992 |
![]() | Protein Hypothetical protein YgiN [117936] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [117937] (2 PDB entries) |
![]() | Domain d1tuva_: 1tuv A: [112665] structural genomics target complexed with vk3 |
PDB Entry: 1tuv (more details), 1.7 Å
SCOP Domain Sequences for d1tuva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tuva_ d.58.4.11 (A:) Hypothetical protein YgiN {Escherichia coli [TaxId: 562]} mltviaeirtrpgqhhrqavldqfakivptvlkeegchgyapmvdcaagvsfqsmapdsi vmieqwesiahleahlqtphmkayseavkgdvlemnirilqpg
Timeline for d1tuva_: