Lineage for d1tuva_ (1tuv A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 723747Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (17 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 723889Family d.58.4.11: PA3566-like [110970] (3 proteins)
    subfamily of Pfam PF03992
  6. 723899Protein Hypothetical protein YgiN [117936] (1 species)
  7. 723900Species Escherichia coli [TaxId:562] [117937] (2 PDB entries)
  8. 723901Domain d1tuva_: 1tuv A: [112665]
    structural genomics target
    complexed with vk3

Details for d1tuva_

PDB Entry: 1tuv (more details), 1.7 Å

PDB Description: Crystal structure of YgiN in complex with menadione
PDB Compounds: (A:) Protein ygiN

SCOP Domain Sequences for d1tuva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tuva_ d.58.4.11 (A:) Hypothetical protein YgiN {Escherichia coli [TaxId: 562]}
mltviaeirtrpgqhhrqavldqfakivptvlkeegchgyapmvdcaagvsfqsmapdsi
vmieqwesiahleahlqtphmkayseavkgdvlemnirilqpg

SCOP Domain Coordinates for d1tuva_:

Click to download the PDB-style file with coordinates for d1tuva_.
(The format of our PDB-style files is described here.)

Timeline for d1tuva_: