Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.11: PA3566-like [110970] (5 proteins) subfamily of Pfam PF03992 |
Protein Hypothetical protein YgiN [117936] (1 species) |
Species Escherichia coli [TaxId:562] [117937] (2 PDB entries) Uniprot P0ADU2 P40718 |
Domain d1tuva_: 1tuv A: [112665] structural genomics target complexed with vk3 |
PDB Entry: 1tuv (more details), 1.7 Å
SCOPe Domain Sequences for d1tuva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tuva_ d.58.4.11 (A:) Hypothetical protein YgiN {Escherichia coli [TaxId: 562]} mltviaeirtrpgqhhrqavldqfakivptvlkeegchgyapmvdcaagvsfqsmapdsi vmieqwesiahleahlqtphmkayseavkgdvlemnirilqpg
Timeline for d1tuva_: