Lineage for d1tuva_ (1tuv A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2949910Family d.58.4.11: PA3566-like [110970] (5 proteins)
    subfamily of Pfam PF03992
  6. 2949936Protein Hypothetical protein YgiN [117936] (1 species)
  7. 2949937Species Escherichia coli [TaxId:562] [117937] (2 PDB entries)
    Uniprot P0ADU2 P40718
  8. 2949938Domain d1tuva_: 1tuv A: [112665]
    structural genomics target
    complexed with vk3

Details for d1tuva_

PDB Entry: 1tuv (more details), 1.7 Å

PDB Description: Crystal structure of YgiN in complex with menadione
PDB Compounds: (A:) Protein ygiN

SCOPe Domain Sequences for d1tuva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tuva_ d.58.4.11 (A:) Hypothetical protein YgiN {Escherichia coli [TaxId: 562]}
mltviaeirtrpgqhhrqavldqfakivptvlkeegchgyapmvdcaagvsfqsmapdsi
vmieqwesiahleahlqtphmkayseavkgdvlemnirilqpg

SCOPe Domain Coordinates for d1tuva_:

Click to download the PDB-style file with coordinates for d1tuva_.
(The format of our PDB-style files is described here.)

Timeline for d1tuva_: