![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins) |
![]() | Protein Class pi GST [81347] (4 species) |
![]() | Species Onchocerca volvulus [TaxId:6282] [116911] (2 PDB entries) |
![]() | Domain d1tu7b1: 1tu7 B:78-208 [112655] Other proteins in same PDB: d1tu7a2, d1tu7b2 complexed with gol, gtt |
PDB Entry: 1tu7 (more details), 1.5 Å
SCOP Domain Sequences for d1tu7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tu7b1 a.45.1.1 (B:78-208) Class pi GST {Onchocerca volvulus} genemettyidmfcegvrdlhvkytrmiymayetekdpyiksilpgelakfekllatrgn grnlilgdkisyadyalfeeldvhqildphcldkfpllkvfhqrmkdrpklkeycekrda akvpvngngkq
Timeline for d1tu7b1: