Lineage for d1tu7b1 (1tu7 B:78-208)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996612Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1996613Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1996614Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 protein domains)
  6. 1996931Protein Class pi GST [81347] (4 species)
  7. 1997078Species Onchocerca volvulus [TaxId:6282] [116911] (2 PDB entries)
    Uniprot P46427
  8. 1997080Domain d1tu7b1: 1tu7 B:78-208 [112655]
    Other proteins in same PDB: d1tu7a2, d1tu7b2
    complexed with gol, gsh

Details for d1tu7b1

PDB Entry: 1tu7 (more details), 1.5 Å

PDB Description: Structure of Onchocerca Volvulus Pi-class Glutathione S-transferase
PDB Compounds: (B:) Glutathione S-transferase 2

SCOPe Domain Sequences for d1tu7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tu7b1 a.45.1.1 (B:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]}
genemettyidmfcegvrdlhvkytrmiymayetekdpyiksilpgelakfekllatrgn
grnlilgdkisyadyalfeeldvhqildphcldkfpllkvfhqrmkdrpklkeycekrda
akvpvngngkq

SCOPe Domain Coordinates for d1tu7b1:

Click to download the PDB-style file with coordinates for d1tu7b1.
(The format of our PDB-style files is described here.)

Timeline for d1tu7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tu7b2