Lineage for d1tu4d_ (1tu4 D:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 581859Family c.37.1.8: G proteins [52592] (45 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 582169Protein Rab5a [82399] (1 species)
  7. 582170Species Human (Homo sapiens) [TaxId:9606] [82400] (11 PDB entries)
  8. 582183Domain d1tu4d_: 1tu4 D: [112652]
    complexed with co, gdp, so4

Details for d1tu4d_

PDB Entry: 1tu4 (more details), 2.2 Å

PDB Description: Crystal Structure of Rab5-GDP Complex

SCOP Domain Sequences for d1tu4d_:

Sequence, based on SEQRES records: (download)

>d1tu4d_ c.37.1.8 (D:) Rab5a {Human (Homo sapiens)}
nkicqfklvllgesavgksslvlrfvkgqfhefqestigaafltqtvclddttvkfeiwd
tagqeryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgnka
dlankravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakklp

Sequence, based on observed residues (ATOM records): (download)

>d1tu4d_ c.37.1.8 (D:) Rab5a {Human (Homo sapiens)}
nkicqfklvllgesavgksslvlrfvkgqfhestigaafltqtvclddttvkfeiwdtag
qeryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgnkadla
nkravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakklp

SCOP Domain Coordinates for d1tu4d_:

Click to download the PDB-style file with coordinates for d1tu4d_.
(The format of our PDB-style files is described here.)

Timeline for d1tu4d_: