SCOP 1.75: Domain d1tu4c_: 1tu4 C:

Lineage for d1tu4c_ (1tu4 C:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab5a [82399] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82400] (11 PDB entries)
   Uniprot P20339 18-182

8. Domain d1tu4c_: 1tu4 C: [112651]

Details for d1tu4c_

PDB Entry: 1tu4, 2.2 Å

PDB Description: Crystal Structure of Rab5-GDP Complex

PDB Compounds: (C:) Ras-related protein Rab-5A

SCOP Domain Sequences for d1tu4c_:

Sequence; same for both SEQRES and ATOM records:

>d1tu4c_ c.37.1.8 (C:) Rab5a {Human (Homo sapiens) [TaxId: 9606]}
gnkicqfklvllgesavgksslvlrfvkgqfhefqestigaafltqtvclddttvkfeiw
dtagqeryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgnk
adlankravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakklpk

Timeline for d1tu4c_:

• d1tu4c_ first appeared in SCOP 1.71
  
• d1tu4c_ appears in SCOP 1.73
  
• d1tu4c_ appears in SCOPe 2.01
  
• d1tu4c_ appears in the current release, SCOPe 2.08