Lineage for d1tu4b_ (1tu4 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2124824Protein Rab5a [82399] (1 species)
  7. 2124825Species Human (Homo sapiens) [TaxId:9606] [82400] (12 PDB entries)
    Uniprot P20339 18-182
  8. 2124838Domain d1tu4b_: 1tu4 B: [112650]
    complexed with co, gdp, so4

Details for d1tu4b_

PDB Entry: 1tu4 (more details), 2.2 Å

PDB Description: Crystal Structure of Rab5-GDP Complex
PDB Compounds: (B:) Ras-related protein Rab-5A

SCOPe Domain Sequences for d1tu4b_:

Sequence, based on SEQRES records: (download)

>d1tu4b_ c.37.1.8 (B:) Rab5a {Human (Homo sapiens) [TaxId: 9606]}
icqfklvllgesavgksslvlrfvkgqfhefqestigaafltqtvclddttvkfeiwdta
gqeryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgnkadl
ankravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakklp

Sequence, based on observed residues (ATOM records): (download)

>d1tu4b_ c.37.1.8 (B:) Rab5a {Human (Homo sapiens) [TaxId: 9606]}
icqfklvllgesavgksslvlrfvkgqfqestigaafltqtvclddttvkfeiwdtagqe
ryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgnkadlank
ravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakklp

SCOPe Domain Coordinates for d1tu4b_:

Click to download the PDB-style file with coordinates for d1tu4b_.
(The format of our PDB-style files is described here.)

Timeline for d1tu4b_: